Gene Mb0879
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb0879, -, len: 134 aa. Equivalent to Rv0856, len: 134 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 134 aa overlap). Conserved hypothetical protein, showing weak similarity with NP_301674.1| (NC_002677) conserved hypothetical protein from Mycobacterium leprae (144 aa); and SC6G10.02c|T35511 hypothetical protein from Streptomyces coelicolor (144 aa). Also highly similar to other proteins from Mycobacterium tuberculosis e.g. neighbouring ORF downstream Rv0857 CONSERVED HYPOTHETICAL PROTEIN (126 aa),FASTA scores: E(): 7.4e-27, (62.0% identity in 100 aa overlap); neighbouring ORF Rv0854|MTV043_47 CONSERVED HYPOTHETICAL PROTEIN (147 aa), FASTA scores: E(): 1.6e-15,(36.6% identity in 123 aa overlap),MTCI28.04|Z97050|MTCI28_4 (184 aa), FASTA scores: opt: 127, E(): 0.036, (26.0% identity in 127 aa overlap); and MLCL622.27c|Z95398 (156 aa), FASTA scores: opt: 123, E(): 0.06, (26.4% identity in 125 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 953579 | 953983 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0879|Mb0879
MEALADVGVLASWSPLHKQVEVIDYYPDGRPHHVRATVKILGLVDKEVLEYHWGPDWVCWDADQTFQQHGQHIEYTVKPEGVDRARVRFDITVEPAGPIPGFIVKRASEHVLDAAAKGLQKLIAGAGDQGNAKS
Bibliography
No article yet recorded