Gene Rv0858c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in biosynthesis of diaminopimelate and lysine from aspartate semialdehyde (at the fourth step) [catalytic activity: L-glutamate + N-succinyl-2-amino-6-ketopimelate = 2-oxoglutarate + N-succinyl-L,L-2,6-diaminopimelate |
| Product | Probable N-succinyldiaminopimelate aminotransferase DapC (DAP-at) |
| Comments | Rv0858c, (MTV043.51c), len: 397 aa. Probable dapC, N-succinyldiaminopimelate aminotransferase, highly similar to others from Eukaryota and bacteria, especially aspartate aminotransferases (transaminases), e.g. NP_177890.1|NC_003070 putative aminotransferase from Arabidopsis thaliana (440 aa); NP_419555.1|NC_002696 aminotransferase class I from Caulobacter crescentus (385 aa); NP_415133.1|NC_000913|AE0001|ECAE000165_8 putative aminotransferase from Escherichia coli strain K12 (386 aa), FASTA scores: opt: 830, E(): 0, (38.0% identity in 389 aa overlap); X99521|TAX99521_1 aspartate aminotransferase from Thermus aquaticus (383 aa), FASTA scores: opt: 702, E(): 0, (34.9% identity in 393 aa overlap); etc. Also similar to other putative aminotransferases from Mycobacterium tuberculosis e.g. Rv2294, Rv3565, etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 953727 | 954920 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0858c|dapC
MTVSRLRPYATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGQASQQADVWNHLVRFTFCKRDDTLDEAIRRLSVLAERPAT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Weyand S et al. [2006]. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of DapC (Rv0858c) from Mycobacterium tuberculosis. Structure
- Weyand S et al. [2007]. The three-dimensional structure of N-succinyldiaminopimelate aminotransferase from Mycobacterium tuberculosis. Product Structure
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
