Gene Mb0881c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable n-succinyldiaminopimelate aminotransferase dapc (dap-at) |
| Comments | Mb0881c, -, len: 397 aa. Equivalent to Rv0858c,len: 397 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 397 aa overlap). Probable aminotransferase (EC 2.6.1.-), highly similar to others from Eukaryota and bacteria, especially aspartate aminotransferases (transaminases) (EC 2.6.1.1), e.g. NP_177890.1|NC_003070 putative aminotransferase from Arabidopsis thaliana (440 aa); NP_419555.1|NC_002696 aminotransferase class I from Caulobacter crescentus (385 aa); NP_415133.1|NC_000913|AE0001|ECAE000165_8 putative aminotransferase from Escherichia coli strain K12 (386 aa), FASTA scores: opt: 830, E(): 0, (38.0% identity in 389 aa overlap); X99521|TAX99521_1 aspartate aminotransferase from Thermus aquaticus (383 aa), FASTA scores: opt: 702, E(): 0, (34.9% identity in 393 aa overlap); etc. Also similar to other putative aminotransferases from Mycobacterium tuberculosis e.g. Rv2294, Rv3565, etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 954481 | 955674 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0881c|dapc
MTVSRLRPYATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGQASQQADVWNHLVRFTFCKRDDTLDEAIRRLSVLAERPAT
Bibliography
No article yet recorded