Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown, but involvement in lipid degradation.
ProductPossible acyl-CoA thiolase FadA
CommentsRv0859, (MTV043.52), len: 403 aa. Possible fadA, acyl-CoA thiolase, equivalent to NP_302423.1|NC_002677 putative beta-ketoadipyl CoA thiolase from Mycobacterium leprae (403 aa). Also highly similar to acyl/acetyl-CoA thiolases and beta-ketoadipyl CoA thiolases, e.g. T35428 probable acetyl CoA acetyltransferase (thiolase) from Streptomyces coelicolor (404 aa); NP_250427.1|NC_002516 probable acyl-CoA thiolase from Pseudomonas aeruginosa (401 aa); NP_106253.1|NC_002678 probable acyl-CoA thiolase from Mesorhizobium loti (402 aa); NP_248919.1|NC_002516|PcaF beta-ketoadipyl CoA thiolase PcaF from Pseudomonas aeruginosa (401 aa); etc. Contains PS00098 Thiolases acyl-enzyme intermediate signature, PS00737 Thiolases signature 2 and PS00099 Thiolases active site.
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS955077956288+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0859|fadA
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVSPVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVESMSRVPMGSDGGAMGLDPATNYDVMFVPQSIGADLIATIEGFSREDVDAYALRSQQKAAEAWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQKYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIMLTGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHPLGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV