Gene Rv0864
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Involved in the biosynthesis of molybdopterin. |
Product | Probable molybdenum cofactor biosynthesis protein C 2 MoaC2 |
Comments | Rv0864, (MTV043.57), len: 167 aa. Probable moaC2, molybdopterin cofactor biosynthesis protein, highly similar to others e.g. CAB59676.1|AL132674 molybdenum cofactor biosynthesis protein from Streptomyces coelicolor (170 aa); NP_418834.1|NC_002696 molybdenum cofactor biosynthesis protein C from Caulobacter crescentus (186 aa); Y10817|ANY10817_3|T44852 molybdopterin co-factor synthesis protein moaC from Arthrobacter nicotinovorans plasmid pAO1 (169 aa), FASTA scores: opt: 491, E(): 2.4e-29, (51.0% identity in 151 aa overlap); etc. Also highly similar to O05788|MOAC1|Rv3111|MTCY164.21 putative molybdenum cofactor biosynthesis protein C from Mycobacterium tuberculosis (170 aa), FASTA scores: opt: 491, E(): 2.4e-29, (54.9% identity in 153 aa overlap); and O53376|Rv3324c|MOAC3|MTV016.24c putative molybdenum cofactor biosynthesis protein C3 (177 aa). |
Functional category | Intermediary metabolism and respiration |
Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 962890 | 963393 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0864|moaC2 MARASGASDYRSGELSHQDERGAAHMVDITEKATTKRTAVAAGILRTSAQVVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFTVGQLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALIDDIRVLHKEGGRRGTWTRR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant