Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the biosynthesis of molybdopterin.
ProductProbable molybdenum cofactor biosynthesis protein C 2 MoaC2
CommentsRv0864, (MTV043.57), len: 167 aa. Probable moaC2, molybdopterin cofactor biosynthesis protein, highly similar to others e.g. CAB59676.1|AL132674 molybdenum cofactor biosynthesis protein from Streptomyces coelicolor (170 aa); NP_418834.1|NC_002696 molybdenum cofactor biosynthesis protein C from Caulobacter crescentus (186 aa); Y10817|ANY10817_3|T44852 molybdopterin co-factor synthesis protein moaC from Arthrobacter nicotinovorans plasmid pAO1 (169 aa), FASTA scores: opt: 491, E(): 2.4e-29, (51.0% identity in 151 aa overlap); etc. Also highly similar to O05788|MOAC1|Rv3111|MTCY164.21 putative molybdenum cofactor biosynthesis protein C from Mycobacterium tuberculosis (170 aa), FASTA scores: opt: 491, E(): 2.4e-29, (54.9% identity in 153 aa overlap); and O53376|Rv3324c|MOAC3|MTV016.24c putative molybdenum cofactor biosynthesis protein C3 (177 aa).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS962890963393+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0864|moaC2
MARASGASDYRSGELSHQDERGAAHMVDITEKATTKRTAVAAGILRTSAQVVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFTVGQLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALIDDIRVLHKEGGRRGTWTRR