Gene Mb0888
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable molybdenum cofactor biosynthesis protein c 2 moac2 |
| Comments | Mb0888, moaC2, len: 142 aa. Similar to Rv0864, len: 167 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 142 aa overlap). Probable moaC2,molybdopterin cofactor biosynthesis protein, highly similar to others e.g. CAB59676.1|AL132674 molybdenum cofactor biosynthesis protein from Streptomyces coelicolor (170 aa); NP_418834.1|NC_002696 molybdenum cofactor biosynthesis protein C from Caulobacter crescentus (186 aa); Y10817|ANY10817_3|T44852 molybdopterin co-factor synthesis protein moaC from Arthrobacter nicotinovorans plasmid pAO1 (169 aa), FASTA scores: opt: 491, E(): 2.4e-29, (51.0% identity in 151 aa overlap); etc. Also highly similar to O05788|MOAC1|Rv3111|MTCY164.21 PUTATIVE MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C from Mycobacterium tuberculosis (170 aa), FASTA scores: opt: 491, E(): 2.4e-29, (54.9% identity in 153 aa overlap); and O53376|Rv3324c|MOAC3|MTV016.24c PUTATIVE MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C3 (177 aa). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a frameshift due to a single base deletion (g-*) leads to a different NH2 part compared to its homolog in Mycobacterium tuberculosis strain H37Rv. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 963665 | 964093 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0888|moaC2
MVDITEKATTKRTAVAAGILRTSAQVVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFTVGQLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALIDDIRVLHKEGGRRGTWTRR
Bibliography
No article yet recorded