Gene Rv0865
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in molybdopterin biosynthesis; involved in the biosynthesis of a demolybdo-cofactor (molybdopterin), necessary for molybdo-enzymes. |
| Product | Probable molybdopterin biosynthesis Mog protein |
| Comments | Rv0865, (MTV043.58), len: 160 aa. Probable mog, molybdopterin biosynthesis MOG protein, highly similar or similar to other molybdenum cofactor biosynthesis proteins e.g. CAB59675.1|AL132674 molybdenum cofactor biosynthesis protein from Streptomyces coelicolor (179 aa); NP_301253.1|NC_002677 putative molybdenum cofactor biosynthesis protein from Mycobacterium leprae (181 aa); CAC39235.1|AJ312124 Mog protein from Eubacterium acidaminophilum (162 aa); P44645|MOG_HAEIN|MOGA|HI0336 molybdopterin biosynthesis MOG protein from Haemophilus influenzae (197 aa), FASTA scores: opt: 306, E(): 9e-13, (39.6% identity in 139 aa overlap); P28694|MOG_ECOLI molybdopterin biosynthesis MOG protein from Escherichia coli (195 aa), FASTA scores: opt: 265, E(): 3.6e-10, (34.2 identity in 146 aa overlap); etc. Also highly similar to Rv0984|MTV044.12|MOAB2 possible pterin-4-alpha-carbinolamine dehydratase from Mycobacterium tuberculosis (181 aa). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 963390 | 963872 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0865|mog
MSTRSARIVVVSSRAAAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADGNPVGEALHDAVNAGVDVIITSGGTGISPTDTTPEHTVAVLDYVIPGLADAIRRSGLPKVPTSVLSRGVCGVAGRTLIINLPGSPGGVRDGLGVLADVLDHALEQIAGGDHPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mueller-Dieckmann C et al. [2007]. On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths. Structure
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
