Gene Mb0889
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable molybdopterin biosynthesis mog protein |
| Comments | Mb0889, mog, len: 160 aa. Equivalent to Rv0865,len: 160 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 160 aa overlap). Probable mog,molybdopterin biosynthesis MOG protein, highly similar or similar to other molybdenum cofactor biosynthesis proteins e.g. CAB59675.1|AL132674 molybdenum cofactor biosynthesis protein from Streptomyces coelicolor (179 aa); NP_301253.1|NC_002677 putative molybdenum cofactor biosynthesis protein from Mycobacterium leprae (181 aa); CAC39235.1|AJ312124 Mog protein from Eubacterium acidaminophilum (162 aa); P44645|MOG_HAEIN|MOGA|HI0336 MOLYBDOPTERIN BIOSYNTHESIS MOG PROTEIN from Haemophilus influenzae (197 aa), FASTA scores: opt: 306, E(): 9e-13,(39.6% identity in 139 aa overlap); P28694|MOG_ECOLI MOLYBDOPTERIN BIOSYNTHESIS MOG PROTEIN from Escherichia coli (195 aa), FASTA scores: opt: 265, E(): 3.6e-10, (34.2 identity in 146 aa overlap); etc. Also highly similar to Rv0984|MTV044.12|MOAB2 POSSIBLE PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE from Mycobacterium tuberculosis (181 aa). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 964090 | 964572 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0889|mog
MSTRSARIVVVSSRAAAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADGNPVGEALHDAVNAGVDVIITSGGTGISPTDTTPEHTVAVLDYVIPGLADAIRRSGLPKVPTSVLSRGVCGVAGRTLIINLPGSPGGVRDGLGVLADVLDHALEQIAGGDHPR
Bibliography
No article yet recorded
