Gene Rv0880
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein (possibly MarR-family) |
| Comments | Rv0880, (MTCY31.08), len: 143 aa. Possible transcriptional regulator, MarR family, equivalent to MLCB57_15|O3306|NP_302411.1|NC_002677 putative MarR-family protein from Mycobacterium leprae (143 aa), FASTA scores: opt: 818, E(): 0, (89.5% identity in 143 aa overlap). Also similar to many others e.g. CAB93410.1|AL357524 putative marR-family protein from Streptomyces coelicolor (145 aa); NP_251757.1|NC_002516 probable transcriptional regulator from Pseudomonas aeruginosa (147 aa); etc. Also similar to Rv2327 from Mycobacterium tuberculosis (163 aa). |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 978934 | 979365 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0880|Rv0880
VLDSDARLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMTPGALAIRERVRPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAELVKAARRARQEWLAERLATLNRSERDILRSAADLMLALVDESP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
