Gene Rv0883c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0883c, (MTCY31.11c), len: 253 aa. Conserved hypothetical protein, equivalent to O3306|MLCB57_16 conserved hypothetical protein from Mycobacterium leprae (251 aa), FASTA scores: E(): 0, (79.4% identity in 253 aa overlap). Also highly similar to N_terminus of AL009204|SC9B10_22 hypothetical protein from Streptomyces coelicolor (352 aa), FASTA scores: E(): 6.1e-20, (35.0% identity in 246 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 980506 | 981267 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0883c|Rv0883c
MRELKVVGLDADGKNIICQGAIPSEQFKLPVDDRLRAALRDDSVQPEQAQLDIEVTNVLSPKEIQARIRAGASVEQVAAASGSDIARIRRFAHPVLLERSRAAELATAAHPVLADGPAVLTMQETVAAALVARGLNPDSLTWDAWRNEDSRWTVQLAWKAGRSDNLAHFRFTPGAHGGTATAIDDTAHELINPTFNRPLRPLAPVAHLDFDEPEPAQPTLTVPSAQPVSNRRGKPAIPAWEDVLLGVRSGGRR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
