Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCatalyzes the reversible interconversion of phosphoserine and 2-oxoglutarate to 3-phosphonooxypyruvate and glutamate. Require both in the major phosphorylated pathway of serine biosynthesis and in pyridoxine biosynthesis [catalytic activity: O-phospho-L-serine + 2-oxoglutarate = 3-phosphonooxypyruvate + L-glutamate].
ProductPossible phosphoserine aminotransferase SerC (PSAT)
CommentsRv0884c, (MTCY31.12c), len: 376 aa. Possible serC, phosphoserine aminotransferase, equivalent to MLCB57_17 putative phosphoserine aminotransferase from Mycobacterium leprae (376 aa), FASTA scores: E(): 0, (87.5 identity in 376 aa overlap). Also highly similar to CAC08322.1|AL392149 putative aminotransferase from Streptomyces coelicolor (363 aa); and similar to other phosphoserine aminotransferases e.g. NP_386837.1|NC_003047 putative phosphoserine aminotransferase protein from Sinorhizobium meliloti (392 aa); P52878|SERC_METBA phosphoserine aminotransferase from Methanosarcina barkeri (370 aa); P10658|SERC_RABIT|RABEPIP_1 phosphoserine aminotransferase from Rabbit (370 aa), FASTA scores: opt: 271, E(): 3.5e-11, (24.5% identity in 368 aa overlap); etc. Belongs to class-V of pyridoxal-phosphate-dependent aminotransferases. Cofactor: pyridoxal phosphate.
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spot 0884c identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS981424982554-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0884c|serC
MADQLTPHLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNPFVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSGAGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVVERL
      
Bibliography