Gene Rv0891c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein |
| Comments | Rv0891c, (MTCY31.19c), len: 285 aa. Possible transcriptional regulator, highly similar in N-terminus to NP_302202.1|NC_002677 possible transcriptional regulator from Mycobacterium leprae (1106 aa). Also highly similar to several Mycobacterium tuberculosis putative transcriptional regulators e.g. Q1102|MTCY02B10_22 probable transcriptional regulatory protein (1159 aa), FASTA scores: opt: 702, E(): 8.3e-40, (50.6% identity in 247 aa overlap); MTV036_21; MTV008_44; MTCY02B10_23. Also shows similarity with several adenylate cyclases and hydrolases from other organisms. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 992598 | 993455 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0891c|Rv0891c
VLFNAVHNSLPPNIDIDHAILRGEDHPPTCAKCVARVRISALGSLDLRYHSLRCYAAPPDVGRCEFVPPRRRVLIANQGLDVSRLPPTGTVTLLLADVEESTHLWQMCPEDMATAIAHLDHTVSEAITNHGGVQPVKRYEGDSFVAAFTRASDAAACALDLQRTSLAPIRLRIGLHTGEVQLRDELYVGPTINRTARLRDLAHGGQVVLSAATGDLVTGRLPADAWLVDLGRHPLRGLPRPEWVMQLCHPDIREKFPPLRTAKSSPTSILPAQFTTFVGRRAQIS
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
