Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0911, (MTCY21C12.05), len: 257 aa. Conserved protein, showing similarity with hydroxylases and hypothetical proteins e.g. T35325 probable hydroxylase from Streptomyces coelicolor (265 aa); Q54242 hypothetical protein from Streptomyces, FASTA scores: opt: 372, E(): 8.8e-18, (32.0% identity in 256 aa overlap); AAD04716.1|U77891 doxorubicin biosynthesis enzyme DnrV from Streptomyces peucetius (275 aa); AAA63051.1|U15184 hypothetical protein from Mycobacterium leprae (94 aa); etc. Also similar to Rv0577 hypothetical protein from Mycobacterium tuberculosis (261 aa).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS10153981016171+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0911|Rv0911
VPTRSSAPLGAPCWIDLTTSDVDRAQDFYGTVFGWAFESAGPDYGGYINAAKGGHPVAGLMANRPEFQSPDGWATYFHTVDIGATVAKLAAAGGSSCLDPMEVPGKGFMSLAVDPSGAAFGLWQPLQHHGFEVIGEAGSPVWHQLTTRDYRSVIDFYRQVFGWRTEQISDTDEFCYTTAWFDDQQLLGVMDGSSCLPEGVPSNWTIFFGAEDVDETLRVICDNGGSVVRAAENTPYGRLAAAADPMGVVFNLSSLQA