Gene Rv0913c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible dioxygenase |
| Comments | Rv0913c, (MTCY21C12.07c), len: 502 aa. Possible dioxygenase, showing similarity with others e.g. AAK38744.1|AY029525 carotenoid 9,10-9',10' cleavage dioxygenase from Phaseolus vulgaris (543 aa); CAB56138.1|AL117669 putative dioxygenase from Streptomyces coelicolor (503 aa); AAK06796.1|AF324838_15|AF324838 putative dioxygenase SimC5 from Streptomyces antibioticus (456 aa); Q53353|S65040 lignostilbene-alpha,beta-dioxygenase from Pseudomonas paucimobilis (485 aa), FASTA scores: opt: 310, E(): 3.4e-20, (28.9% identity in 495 aa overlap); etc. Also some similarity with Rv0654|MTCI376.22 probable dioxygenase from Mycobacterium tuberculosis (501 aa). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1017217 | 1018725 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0913c|Rv0913c
MDITIVGKYLSTLPEDDDHPYRTGPWRPQTTEWDADDLTTVTGEVPADLDGIYLRNTENPLHPAFATYHPFDGDGMIHVVGFRDGKAFYRNRFIRTDGFLAENEAGGPLWPGLAEPVQLAKREHGWGARGLMKDASSTDVIVHRGIALTSFYQCGDLYRIDPYSANTLGKESWHGRFPFDWGVSAHPKVDNKTGELLFFNYSKQEPYMRYGVVDQNNELVHYVDVPLPGPRLPHDMAFTENYVILNDFPLFWDPRLLERDVHLPRFYPEIPSRFAVVARRGNDIRWFEADPTFVLHFTNAYEQGDEIVLDGFYEGDPQPLDTGGTKWEKLFRFLALDRLQSRLHRWRLNMVTGAVHEEQLSESITEFGTINADYAASSYRYTYAATGKPSWFLFDGLVKHDLLTGNHECYSFGDGVYGSETAMAPRVGSSAEDDGYLVTLTTDMNDDASYCLVFDAARPGDGPICKLALPERISSGTHSAWVPGAELRRWDHAESPAAAVGL
Bibliography
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant