Gene Rv0915c (MTB41)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown. Possibly a protective antigen involved with the early control of infection. |
| Product | PPE family protein PPE14 |
| Comments | Rv0915c, (MTCY21C12.09c), len: 423 aa. PPE14 (alternate gene name: MTB41). Member of the Mycobacterium tuberculosis PPE family (see citation below), highly similar to many e.g. Rv1807 from Mycobacterium tuberculosis (403 aa), FASTA scores: opt: 966, E(): 4.4e-30, (45.7% identity in 392 aa overlap); etc. Contains PS00626 Regulator of chromosome condensation (RCC1) signature 2. |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1020058 | 1021329 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0915c|PPE14
MDFGLLPPEVNSSRMYSGPGPESMLAAAAAWDGVAAELTSAAVSYGSVVSTLIVEPWMGPAAAAMAAAATPYVGWLAATAALAKETATQARAAAEAFGTAFAMTVPPSLVAANRSRLMSLVAANILGQNSAAIAATQAEYAEMWAQDAAVMYSYEGASAAASALPPFTPPVQGTGPAGPAAAAAATQAAGAGAVADAQATLAQLPPGILSDILSALAANADPLTSGLLGIASTLNPQVGSAQPIVIPTPIGELDVIALYIASIATGSIALAITNTARPWHIGLYGNAGGLGPTQGHPLSSATDEPEPHWGPFGGAAPVSAGVGHAALVGALSVPHSWTTAAPEIQLAVQATPTFSSSAGADPTALNGMPAGLLSGMALASLAARGTTGGGGTRSGTSTDGQEDGRKPPVVVIREQPPPGNPPR
Bibliography
- Skeiky YA et al. [2000]. T cell expression cloning of a Mycobacterium tuberculosis gene encoding a protective antigen associated with the early control of infection. Product
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
