Gene Rv0944
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | This enzyme may play a significant role in processes leading to recovery from mutagenesis and/or cell death by alkylating agents [catalytic activity: hydrolysis of DNA containing ring-opened N7-methylguanine residues, releasing 2,6-diamino-4-hydroxy-5-(N-methyl)formamidopyrimide]. |
| Product | Possible formamidopyrimidine-DNA glycosylase (FAPY-DNA glycosylase) |
| Comments | Rv0944, (MTCY10D7.30c), len: 158 aa. Possible formamidopyrimidine-DNA glycosylase, similar to C-terminus of formamidopyrimidine-DNA glycosylases e.g. CAB63194.1|AL133469 putative formamidopyrimidine-DNA glycosylase from Streptomyces coelicolor (287 aa); FPG_LACLA|NP_266509.1|NC_002662 formamidopyrimidine-DNA glycosylase from Lactococcus lactis subsp. lactis (273 aa), FASTA scores: opt: 246, E(): 2.4e-09, (28.9% identity in 142 aa overlap); O50606|FPG_THETH|MUTM|FPG formamidopyrimidine-DNA glycosylase from Thermus thermophilus (267 aa); etc. Also similar to C-termini of endonucleases or DNA glycosylases of Mycobacterium tuberculosis e.g. Rv3297, Rv2464c, Rv2924c. May belong to the FPG family. |
| Functional category | Information pathways |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1053765 | 1054241 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0944|Rv0944
VAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVAKISPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
