Gene Rv1032c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Sensor part of the two component regulatory system TRCS/TRCR. |
Product | Two component sensor histidine kinase TrcS |
Comments | Rv1032c, (MTCY10G2.17), len: 509 aa. TrcS, two component sensor histidine kinase protein (see citations below), similar to YV16_MYCLE|P54883 probable sensor-like histidine kinase from Mycobacterium leprae (443 aa), FASTA scores: opt: 392, E(): 3.8e-18, (31.7% identity in 334 aa overlap). Note that in vitro autophosphorylation of TrcS requires the presence of Mn2+ or Ca2+ as a divalent cation cofactor and subsequent transphosphorylation of TrcR is evident in the presence of TrcS-phosphate and Ca2+. |
Functional category | Regulatory proteins |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis Mt103 transposon mutant in BALB/c mice and in mouse bone marrow-derived macrophages is unaffected (See Ewann et al., 2002). M. tuberculosis H37Rv mutant shows increased virulence in SCID mice (See Parish et al., 2004). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1156426 | 1157955 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1032c|trcS MIPDRNTRSRKAPCWRPRSLRQQLLLGVLAVVTVVLVAVGVVSVLSLSGYVTAMNDAELVESLHALNHSYTRYRDSAQTSTPTGNLPMSQAVLEFTGQTPGNLIAVLHDGVVIGSAVFSEDGARPAPPDVIRAIEAQVWDGGPPRVESLGSLGAYQVDSSAAGADRLFVGVSLSLANQIIARKKVTTVALVGAALVVTAALTVWVVGYALRPLRRVAATAAEVATMPLTDDDHQISVRVRPGDTDPDNEVGIVGHTLNRLLDNVDGALAHRVDSDLRMRQFITDASHELRTPLAAIQGYAELTRQDSSDLPPTTEYALARIESEARRMTLLVDELLLLSRLSEGEDLETEDLDLTDLVINAVNDAAVAAPTHRWVKNLPDEPVWVNGDHARLHQLVSNLLTNAWVHTQPGVTVTIGITCHRTGPNAPCVELSVTDDGPDIDPEILPHLFDRFVRASKSRSNGSGHGLGLAIVSSIVKAHRGSVTAESGNGQTVFRVRLPMIEQQIATTA
Bibliography
- Haydel SE et al. [1999]. In vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins. Product Regulation Biochemistry
- Ewann F, Jackson M, Pethe K, Cooper A, Mielcarek N, Ensergueix D, Gicquel B, Locht C and Supply P [2002]. Transient requirement of the PrrA-PrrB two-component system for early intracellular multiplication of Mycobacterium tuberculosis. Mutant
- Parish T et al. [2003]. Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis. Mutant Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant