Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionSensor part of the two component regulatory system TRCS/TRCR.
ProductTwo component sensor histidine kinase TrcS
CommentsRv1032c, (MTCY10G2.17), len: 509 aa. TrcS, two component sensor histidine kinase protein (see citations below), similar to YV16_MYCLE|P54883 probable sensor-like histidine kinase from Mycobacterium leprae (443 aa), FASTA scores: opt: 392, E(): 3.8e-18, (31.7% identity in 334 aa overlap). Note that in vitro autophosphorylation of TrcS requires the presence of Mn2+ or Ca2+ as a divalent cation cofactor and subsequent transphosphorylation of TrcR is evident in the presence of TrcS-phosphate and Ca2+.
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis Mt103 transposon mutant in BALB/c mice and in mouse bone marrow-derived macrophages is unaffected (See Ewann et al., 2002). M. tuberculosis H37Rv mutant shows increased virulence in SCID mice (See Parish et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS11564261157955-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1032c|trcS
MIPDRNTRSRKAPCWRPRSLRQQLLLGVLAVVTVVLVAVGVVSVLSLSGYVTAMNDAELVESLHALNHSYTRYRDSAQTSTPTGNLPMSQAVLEFTGQTPGNLIAVLHDGVVIGSAVFSEDGARPAPPDVIRAIEAQVWDGGPPRVESLGSLGAYQVDSSAAGADRLFVGVSLSLANQIIARKKVTTVALVGAALVVTAALTVWVVGYALRPLRRVAATAAEVATMPLTDDDHQISVRVRPGDTDPDNEVGIVGHTLNRLLDNVDGALAHRVDSDLRMRQFITDASHELRTPLAAIQGYAELTRQDSSDLPPTTEYALARIESEARRMTLLVDELLLLSRLSEGEDLETEDLDLTDLVINAVNDAAVAAPTHRWVKNLPDEPVWVNGDHARLHQLVSNLLTNAWVHTQPGVTVTIGITCHRTGPNAPCVELSVTDDGPDIDPEILPHLFDRFVRASKSRSNGSGHGLGLAIVSSIVKAHRGSVTAESGNGQTVFRVRLPMIEQQIATTA