Gene Rv1034c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly required for the transposition of the insertion element IS1560. |
| Product | Probable transposase (fragment) |
| Comments | Rv1034c, (MTCY10G2.15), len: 129 aa. Probable IS1560 transposase fragment, similar to part of Rv3387|E1202305|MTV004.45 (225 aa) (65.1% identity in 129 aa overlap). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1158918 | 1159307 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1034c|Rv1034c
VQQGNPPDAPQLAPAVAWVKKRAGRTPRTVTADRGYGEAAVDQQLTEVGVKNVLIPRKGKPSQDRRAEEHRKAFRRTIKWRTGCEGRISHLKRGYGWDRGRIGGLEGTRTWVGHGVFAHNLVTISALPA
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
