Gene Rv1035c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly required for the transposition of the insertion element IS1560. |
| Product | Probable transposase (fragment) |
| Comments | Rv1035c, (MTCY10G2.14), len: 228 aa. Probable IS1560 transposase fragment, similar to parts of Rv3387|E1202305|MTV004.45 (225 aa) (47.8% identity in 67 aa overlap) and Rv3386|E1202304|MTV004.44 (234 aa) (55.1% identity in 127 aa overlap). |
| Functional category | Insertion seqs and phages |
| Proteomics | Identified in the cytosol, cell wall, and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1159375 | 1160061 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1035c|Rv1035c
VPHPTTLMKLTTRCGSAAIDGLNEALLAKAAEAKLLGTNRIRADTTVARANVSYPTDLGLLAKAMRRIAATGKRIQAAGGAVRTRVGDRSRAAGRRAHAVAAKLRSRAELGRDEARAAVLRFTGELAELAQAAAQEAQQLLDNAKQAVLRAKAKAAALAARGERDAVAGRRCGGLVRAVNDLTELLNATRQIVAQTRQRVAGITSDGASRRVSLHDGDARPDHQGSAR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
