Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductESAT-6 like protein EsxJ (ESAT-6 like protein 2)
CommentsRv1038c, (MT1067, MTCY10G2.11), len: 98 aa. EsxJ, ESAT-6 like protein (see Gey Van Pittius et al., 2001), similar to Q49945|U1756C, Mycobacterium leprae (100 aa), FASTA scores: opt: 375, E(): 7.7e-21, (58.3% identity in 96 aa overlap). Member of M. tuberculosis hypothetical QILSS protein family with Rv1197, Rv1792, Rv2347c and Rv3620c. Belongs to the ESAT6 family.
Functional categoryCell wall and cell processes
ProteomicsThe product of this CDS could be spot TB11.0 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS11608551161151-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1038c|esxJ
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS