Gene Mb1067c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esat-6 like protein esxj (esat-6 like protein 2) |
| Comments | Mb1067c, esxJ, len: 98 aa. Equivalent to Rv1038c,len: 98 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 98 aa overlap). esxJ, putative ESAT-6 like protein 2, similar to Q49945|U1756C, Mycobacterium leprae (100 aa), FASTA scores: opt: 375, E(): 7.7e-21,(58.3% identity in 96 aa overlap), almost identical to Rv1197, Rv1792, Rv2347c and Rv3620c. BELONGS TO THE ESAT6 FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1161302 | 1161598 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1067c|esxJ
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
Bibliography
No article yet recorded