Gene Rv1046c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv1046c, (MTCY10G2.03), len: 174 aa. Hypothetical unknown protein. Start changed since first submission (-65 aa). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Unknown |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain but mutant is less virulent in SCID mice (see McAdam et al., 2002). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1168704 | 1169228 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1046c|Rv1046c
LKVQARVGWNRRQLSAVGGRGQQLFANAPGHIPSTSHRRGTGDINRKIDESLAGAARPQANANYGATSDPPLTHQPKPGSPTQVGPRSPSPPGLRGLVKQLPEVHQSSLHLDTVASLPSSRPSPHHTPLALRSRSGHFSPDEIRNRRSRKRSQSHMPPRTPPRGRCLRAPEALA
Bibliography
- McAdam RA, Quan S, Smith DA, Bardarov S, Betts JC, Cook FC, Hooker EU, Lewis AP, Woollard P, Everett MJ, Lukey PT, Bancroft GJ, Jacobs Jr WR and Duncan K [2002]. Characterization of a Mycobacterium tuberculosis H37Rv transposon library reveals insertions in 351 ORFs and mutants with altered virulence. Mutant
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
