Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv1046c, (MTCY10G2.03), len: 174 aa. Hypothetical unknown protein. Start changed since first submission (-65 aa). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryUnknown
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene for growth in vitro by Tn5370 transposon mutagenesis of H37Rv strain but mutant is less virulent in SCID mice (see McAdam et al., 2002).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS11687041169228-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1046c|Rv1046c
LKVQARVGWNRRQLSAVGGRGQQLFANAPGHIPSTSHRRGTGDINRKIDESLAGAARPQANANYGATSDPPLTHQPKPGSPTQVGPRSPSPPGLRGLVKQLPEVHQSSLHLDTVASLPSSRPSPHHTPLALRSRSGHFSPDEIRNRRSRKRSQSHMPPRTPPRGRCLRAPEALA