Gene Rv1055
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Use for sequence integration. Integrase is necessary for integration of a phage into the host genome by site-specific recombination. In conjunction with excisionase, integrase is also necessary for excision of the prophage from the host genome. |
| Product | Possible integrase (fragment) |
| Comments | Rv1055, (MTV017.08), len: 44 aa. Possible integrase (fragment); first 49 aa similar to Rv2309c|MTCY3G12_25|Z79702 hypothetical protein (shows similarity to integrases) from Mycobacterium tuberculosis (151 aa), FASTA scores: opt: 291, E(): 2.2e-16, (74.3% identity in 70 aa overlap); and to L39071|MSGINT_1 integrase from Mycobacterium paratuberculosis (191 aa), FASTA scores: opt: 146, E(): 8.3e-05, (52.1% identity in 48 aa overlap); and to many other integrases or transposases. Shortened since first submission (-34 aa). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1177239 | 1177373 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1055|Rv1055
MTLDRHGHLLNDDLAVWPMRCAKSSRTLRYHCGMRRRNRVGLRA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
