Gene Rv1072
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | Rv1072, (MTV017.25), len: 278 aa. Probable conserved transmembrane protein, equivalent to O07139|B1306.07|Y13803 Protein B1306.07 from Mycobacterium leprae (220 aa), FASTA scores: opt:1032, E(): 0, (75.0% identity in 220 aa overlap); and at the C-terminal end to Q50056|U1740D Mycobacterium leprae (96 aa), FASTA scores: opt: 381, E(): 1.2e-18, (71.6% identity in 81 aa overlap). Similar to Q54192|M80628|STMBLDA_1 transfer RNA-LEU (BLDA) gene and ORF from Streptomyces griseus (293 aa), FASTA scores: opt:558, E(): 4.7e-30, (41.5% identity in 299 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1196279 | 1197115 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1072|Rv1072
VRETSNPVFRSLPKQRGGYAQFGTGTAQQGFPADPYLAPYREAKATRPLTIDDVVTKTGLTLAMLAGTAVVSYFLVASNVALAMPLTLVGALGGLALVLVATFGRKQDNPAIVLSYAALEGLFLGAISFVLANFTVASANAGVLIGEAILGTMGVFFGMLVVYKTGAIRVTPKFTRMVVAALFGVLVLMLGNLVLAMFNVGGGEGLGLRSPGPLGIIFSLVCIGIAAFSFLIDFDAADQMIRAGAPEKAAWGVALGLTVTLVWLYIEILRLLSYLQNE
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
