Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThe biological conversion of cellulose to glucose generally requires three types of hydrolytic enzymes: (1) endoglucanases which cut internal beta-1,4-glucosidic bonds; (2) exocellobiohydrolases that cut the dissaccharide cellobiose from the nonreducing end of the cellulose polymer chain; (3) beta-1,4-glucosidases which hydrolyze the cellobiose and other short cello-oligosaccharides to glucose [catalytic activity:endohydrolysis of 1,4-beta-D-glucosidic linkages in cellulose].
ProductProbable cellulase CelA2a (endo-1,4-beta-glucanase) (endoglucanase) (carboxymethyl cellulase)
CommentsRv1089A, len: 34 aa. Probable celA2a, first part of cellulase (endoglucanase), similar to N-terminus of others. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS12155171215621+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1089A|celA2a
MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY