Gene Rv1089A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The biological conversion of cellulose to glucose generally requires three types of hydrolytic enzymes: (1) endoglucanases which cut internal beta-1,4-glucosidic bonds; (2) exocellobiohydrolases that cut the dissaccharide cellobiose from the nonreducing end of the cellulose polymer chain; (3) beta-1,4-glucosidases which hydrolyze the cellobiose and other short cello-oligosaccharides to glucose [catalytic activity:endohydrolysis of 1,4-beta-D-glucosidic linkages in cellulose]. |
| Product | Probable cellulase CelA2a (endo-1,4-beta-glucanase) (endoglucanase) (carboxymethyl cellulase) |
| Comments | Rv1089A, len: 34 aa. Probable celA2a, first part of cellulase (endoglucanase), similar to N-terminus of others. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1215517 | 1215621 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1089A|celA2a
MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY
Bibliography
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
