Gene Rv1090
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The biological conversion of cellulose to glucose generally requires three types of hydrolytic enzymes: (1) endoglucanases which cut internal beta-1,4-glucosidic bonds; (2) exocellobiohydrolases that cut the dissaccharide cellobiose from the nonreducing end of the cellulose polymer chain; (3) beta-1,4-glucosidases which hydrolyze the cellobiose and other short cello-oligosaccharides to glucose [catalytic activity:endohydrolysis of 1,4-beta-D-glucosidic linkages in cellulose]. |
| Product | Probable cellulase CelA2b (endo-1,4-beta-glucanase) (endoglucanase) (carboxymethyl cellulase) |
| Comments | Rv1090, (MTV017.43), len: 151 aa. Probable celA2b, second part of cellulase (endoglucanase), similar to C-terminus of others e.g. O08468 cellulase CEL2 from Streptomyces halstedi (377 aa), FASTA scores: opt: 554, E(): 1.2e-30, (52.0% identity in 152 aa overlap); etc. Gene appears to have been inactivated by frameshift mutations but no errors could be found that would account for this. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Intermediary metabolism and respiration |
| Transcriptomics | mRNA detected by RT-PCR (See Mba Medie et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1215599 | 1216054 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1090|celA2b
VGTNLPTEVGQILSAPTSIDYNYPTTGVWDASYDICLDSTPKTTGVNQQEIMIWFNHQGSIQPVGSPVGNTTIEGKNFVVWDGSNGMNNAMAYVATEPIEVWSFDVMSFVDHTATMEPITDSWYLTSIRAGLEPWSDGVGLGVDSFSAKVN
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Mba Medie F, Ben Salah I, Drancourt M and Henrissat B [2010]. Paradoxical conservation of a set of three cellulose-targeting genes in Mycobacterium tuberculosis complex organisms. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
