Gene Rv1116A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein (fragment) |
| Comments | Rv1116A, len: 91 aa. Conserved hypothetical protein (possibly gene fragment), similar to C-terminal part of Rv1646|Z85982_9 from Mycobacterium tuberculosis (310 aa), FASTA scores: opt: 301, E(): 9.3e-13, (68.05% identity in 72 aa overlap). Also overlaps gene on other strand, Rv1116, at 3'-end. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1241115 | 1241390 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1116A|Rv1116A
MGALGTVRGLQDSNTAFVGALHSGNLLGATGAVLQAPGNAVNGFLFGQTSISQSIDVSPEYGYELVAVSDPVGGTAGSARAGHGYVHADLR
Bibliography
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
