Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical membrane protein
CommentsRv1139c, (MTCI65.06c), len: 166 aa. Conserved hypothetical membrane protein. Highly similar to P54158|YBPQ_BACSU hypothetical Bacillus subtilis protein, YBPQ (168 aa), FASTA scores: opt: 446, E(): 2.2e-26, (38.4% identity in 164 aa overlap). Some similarity to Mycobacterium tuberculosis hypothetical proteins, Rv0740, Rv0750.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS12664851266985-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1139c|Rv1139c
VYYLLILAVVFERLAELVVAQRNARWSFAQGGKEFGRPHYVVMVILHTALLLGCVVEPWALHRPFIPWLGWPMLAVVVASQGLRWWCVKSLGKRWNTRVIVLPHATLVRRGPYRWMRHPNYVAVVAEGFALPLVHTAWLTALVFTLANATLLTVRLRVENSVLGYI