Gene Rv1149
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly required for the transposition of an insertion element |
| Product | Possible transposase |
| Comments | Rv1149, (MTCI65.16), len: 135 aa. Possible transposase. Identical to 117 aa N-terminal region of S21394|X65618 transposase of Mycobacterium tuberculosis (308 aa), FASTA scores: opt: 823, E(): 0, (99.1% identity in 117 aa overlap). Second copy is Rv1042c|MTCY10G2.07. |
| Functional category | Insertion seqs and phages |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1277893 | 1278300 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1149|Rv1149
VTRVGVISDEFWAVVEPLMPSHEGKPGRRFSDHRLILEGIAWRFRTGSPWRDLPAEFGPWQTVWKRHHRWSLDGTCDEVFAHVAAVFGVDAEVAEDIEKLLSVDSTNVRAHQHSAGACSDTLATGGTVGLQEIRR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
