Gene Rv1225c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1225c, (MTCI61.08c), len: 276 aa. Conserved hypothetical protein, some similarity to other hypothetical proteins e.g. AE001078|AE001078_2 Archaeoglobus fulgidus (265 aa), FASTA scores: opt: 339, E(): 5.1e-15, (27.1% identity in 262 aa overlap), and to NAGD_ECOLI|P15302 nagd protein from Escherichia coli (250 aa), FASTA scores: opt: 167, E(): 6.4e-12, (24.8% identity in 258 aa overlap). Also weakly similar to Mycobacterium tuberculosis hypothetical protein Rv3400|MTCY78.28c (29.1% identity in 251 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1367891 | 1368721 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1225c|Rv1225c
VDVAHLMAAAVLFDIDGVLVLSWRAIPGAAETVRQLTHRGIACAYLTNTTTRTRRQIAEALGAAGIPVAADDVITAGVLTAEYLHGAYPGARCFLVNNGDITEDLPGIDVVLSTEIGPEDCPEAPDVVVLGSAGPQFDHRTLSRVYGWMLDGVPVVAMHRNMTWNTTDGLRIDTGMYLTGMEQACGKTATAIGKPAAEGFLAAADRVGVDPQQMVMIGDDLHNDVLAAQAVGMTGVLVRTGKFRQQTLDRWLAGASATRPHHVIDSVAGLPPLLGC
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
