Gene Rv1230c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible membrane protein |
| Comments | Rv1230c, (MTV006.02c), len: 411 aa. Possible membrane protein with two hydrophobic stretches near N-terminus. Some similarity to Rv1022|MTCY10G2.27c|Z92539 probable lpqU protein Mycobacterium tuberculosis (243 aa), FASTA score: opt: 408, E(): 1e-11, (43.6% identity in 172 aa overlap). Similar to AL133423|SC4A7.37 hypothetical protein from Streptomyces coelicolor (421 aa), FASTA score: opt: 679, E(): 5.1e-23, (36.4% identity in 398 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1372962 | 1374197 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1230c|Rv1230c
VHIGGRWGARPAVAAVRRGACRLTRAPAFGVAAIAPLVFASAVGSAAPVFPGRTAPVHAVITPVAAVAASGIDLSGPVVIAMKRPPTSFRVAVATISAPPPPMIVNSPGALGIPAMALSAYRNAELKMAAAAPGCGVSWNLLAGIGRIESMHANGGATDARGTAIQPIYGPTLDGTLPGNEIIIQSSVGNRVTYARAMGPMQFLPGTWARYATDGDDDGVADPQNLFDSTLAAARYLCSGGLNLRDPAQVMAALLRYNNSMPYAQNVLGWAAGYATGVFPVDLPPITGPPPPLGDAHLENPEGLGPGLPINVNGLTADGPMAHLPLIDLTPRQAALNPPPMFPWMAPDPSAPMPGCTLICIGSHGPPVGAPPFPPTAPPPPFLPAAPPPPDPLAGPPGDAGLAPPAPAPAG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant