Gene Rv1233c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical membrane protein |
| Comments | Rv1233c, (MTV006.05c), len: 198 aa. Conserved hypothetical membrane protein, N-terminus is highly proline rich, C-terminus has two hydrophobic stretches. Proline-rich N-terminus has some similarity to CBPA_DICDI calcium binding protein from Dictyostelium discoideum (467 aa), FASTA scores: E(): 4.8e-06, (35.5% identity in 183 aa overlap). Both sequences share multiple copies of a Tyr-Pro-Pro motif. |
| Functional category | Cell wall and cell processes |
| Transcriptomics | mRNA identified by DNA microarray analysis and possibly down-regulated by hrcA|Rv2374c (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1376230 | 1376826 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1233c|Rv1233c
MTAPSGSSGESAHDAAGGPPPVGERPPEQPIADAPWAPPASSPMANHPPPAYPPSGYPPAYQPGYPTGYPPPMPPGGYAPPGYPPPGTSSAGYGDIPYPPMPPPYGGSPGGYYPEPGYLDGYGPSQPGMNTMALVSLISALVGVLCCIGSIVGIVFGAIAINQIKQTREEGYGLAVAGIVIGIATLLVYMIAGIFAIP
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
