Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical membrane protein
CommentsRv1233c, (MTV006.05c), len: 198 aa. Conserved hypothetical membrane protein, N-terminus is highly proline rich, C-terminus has two hydrophobic stretches. Proline-rich N-terminus has some similarity to CBPA_DICDI calcium binding protein from Dictyostelium discoideum (467 aa), FASTA scores: E(): 4.8e-06, (35.5% identity in 183 aa overlap). Both sequences share multiple copies of a Tyr-Pro-Pro motif.
Functional categoryCell wall and cell processes
TranscriptomicsmRNA identified by DNA microarray analysis and possibly down-regulated by hrcA|Rv2374c (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS13762301376826-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1233c|Rv1233c
MTAPSGSSGESAHDAAGGPPPVGERPPEQPIADAPWAPPASSPMANHPPPAYPPSGYPPAYQPGYPTGYPPPMPPGGYAPPGYPPPGTSSAGYGDIPYPPMPPPYGGSPGGYYPEPGYLDGYGPSQPGMNTMALVSLISALVGVLCCIGSIVGIVFGAIAINQIKQTREEGYGLAVAGIVIGIATLLVYMIAGIFAIP