Gene Rv1236
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in active transport of sugar across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Probable sugar-transport integral membrane protein ABC transporter SugA |
| Comments | Rv1236, (MTV006.08), len: 307 aa. Probable sugA, sugar-transport integral membrane protein ABC transporter (see citation below), equivalent to U15180|MLU1518035 protein malFM from Mycobacterium leprae (310 aa), FASTA scores: opt: 1566, E(): 0, (81.8% identity in 292 aa overlap). Also similar to numerous bacterial sugar transport system components. Also similar to Rv2316|MTCY3G12.18c from Mycobacterium tuberculosis (290 aa), FASTA scores: opt: 514, E(): 7.3e-27, (33.2% identity in 283 aa overlap). Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction; enriched in the membrane fraction and predicted N-terminal signal peptide is uncleaved (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1378927 | 1379850 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1236|sugA
VTSVEQRTATAVFSRTGSRMAERRLAFMLVAPAAMLMVAVTAYPIGYALWLSLQRNNLATPNDTAFIGLGNYHTILIDRYWWTALAVTLAITAVSVTIEFVLGLALALVMHRTLIGKGLVRTAVLIPYGIVTVVASYSWYYAWTPGTGYLANLLPYDSAPLTQQIPSLGIVVIAEVWKTTPFMSLLLLAGLALVPEDLLRAAQVDGASAWRRLTKVILPMIKPAIVVALLFRTLDAFRIFDNIYVLTGGSNNTGSVSILGYDNLFKGFNVGLGSAISVLIFGCVAVIAFIFIKLFGAAAPGGEPSGR
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Titgemeyer F et al. [2007]. A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis. Homology
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
