Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in active transport of sugar across the membrane (import). Responsible for the translocation of the substrate across the membrane.
ProductProbable sugar-transport integral membrane protein ABC transporter SugA
CommentsRv1236, (MTV006.08), len: 307 aa. Probable sugA, sugar-transport integral membrane protein ABC transporter (see citation below), equivalent to U15180|MLU1518035 protein malFM from Mycobacterium leprae (310 aa), FASTA scores: opt: 1566, E(): 0, (81.8% identity in 292 aa overlap). Also similar to numerous bacterial sugar transport system components. Also similar to Rv2316|MTCY3G12.18c from Mycobacterium tuberculosis (290 aa), FASTA scores: opt: 514, E(): 7.3e-27, (33.2% identity in 283 aa overlap). Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction; enriched in the membrane fraction and predicted N-terminal signal peptide is uncleaved (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS13789271379850+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1236|sugA
VTSVEQRTATAVFSRTGSRMAERRLAFMLVAPAAMLMVAVTAYPIGYALWLSLQRNNLATPNDTAFIGLGNYHTILIDRYWWTALAVTLAITAVSVTIEFVLGLALALVMHRTLIGKGLVRTAVLIPYGIVTVVASYSWYYAWTPGTGYLANLLPYDSAPLTQQIPSLGIVVIAEVWKTTPFMSLLLLAGLALVPEDLLRAAQVDGASAWRRLTKVILPMIKPAIVVALLFRTLDAFRIFDNIYVLTGGSNNTGSVSILGYDNLFKGFNVGLGSAISVLIFGCVAVIAFIFIKLFGAAAPGGEPSGR