Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. They oxidize a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
ProductProbable cytochrome P450 130 Cyp130
CommentsRv1256c, (MT1295, MTCY50.26), len: 405 aa. Probable cyp130, cytochrome P450, similar to other cytochromes P-450 e.g. S51594 cytochrome P450 mycG from Micromonospora griseorubida (397 aa); T36526 probable cytochrome P450 hydroxylase from Streptomyces coelicolor (411 aa); CPXK_SACER|P33271|107B1 cytochrome P450 from Saccharopolyspora erythraea (405 aa), FASTA scores: opt: 639, E(): 2.7e-33, (33.2% identity in 391 aa overlap); etc. Also similar to others from Mycobacterium tuberculosis e.g. Rv0766c|MTCY369.11c cytochrome P450 (402 aa); etc. Contains PS00086 Cytochrome P450 cysteine heme-iron ligand signature. Belongs to the cytochrome P450 family.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS14033861404603-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1256c|cyp130
MTSVMSHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEYDYYVLSRHADVWSAARDHQTFSSAQGLTVNYGELEMIGLHDTPPMVMQDPPVHTEFRKLVSRGFTPRQVETVEPTVRKFVVERLEKLRANGGGDIVTELFKPLPSMVVAHYLGVPEEDWTQFDGWTQAIVAANAVDGATTGALDAVGSMMAYFTGLIERRRTEPADDAISHLVAAGVGADGDTAGTLSILAFTFTMVTGGNDTVTGMLGGSMPLLHRRPDQRRLLLDDPEGIPDAVEELLRLTSPVQGLARTTTRDVTIGDTTIPAGRRVLLLYGSANRDERQYGPDAAELDVTRCPRNILTFSHGAHHCLGAAAARMQCRVALTELLARCPDFEVAESRIVWSGGSYVRRPLSVPFRVTS