Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCatalyzes reversible dehydration of CO2 to form bicarbonate
ProductBeta-carbonic anhydrase
CommentsRv1284, (MTCY373.03), len: 163 aa. CanA, Beta-carbonic anhydrase, proven biochemically (See Suarez Covarrubias et al. 2005) similar to others e.g. AL109663|SC4A10.26 hypothetical protein from Streptomyces coelicolor (167 aa), FASTA scores: opt: 567, E(): 1.5e-32, (53.4% identity in 163 aa overla); shows some similarity to hypothetical protein from Methanobacterium thermoautotrophicum. Weak similarity to carbonic anhydrases e.g. U51624|MTU516242|P17582 Methanothermobacter thermautotrophicus (171 aa), FASTA score: opt: 305, E(): 1.2e-14, (35.2% identity in 165 aa overlap).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics (see Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by microarray analysis: up-regulated after 4h, 24h, and 96h (highly) of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS14373241437815+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1284|canA
VTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESYPDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
      
Bibliography