Gene Mb1315
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | beta-carbonic anhydrase |
Comments | Mb1315, -, len: 163 aa. Equivalent to Rv1284, len: 163 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 163 aa overlap). Conserved hypothetical protein, similar to AL109663|SC4A10.26 hypothetical protein from Streptomyces coelicolor (167 aa), FASTA scores: opt: 567, E(): 1.5e-32, (53.4% identity in 163 aa overla); shows some similarity to hypothetical protein from Methanobacterium thermoautotrophicum. Weak similarity to carbonic anhydrases e.g. U51624|MTU516242|P17582 Methanothermobacter thermautotrophicus (171 aa), FASTA score: opt: 305, E(): 1 .2e-14, (35.2% identity in 165 aa overlap). |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1435470 | 1435961 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1315|cana MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESYPDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
Bibliography
No article yet recorded