Gene Mb1315 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | beta-carbonic anhydrase | 
| Comments | Mb1315, -, len: 163 aa. Equivalent to Rv1284, len: 163 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 163 aa overlap). Conserved hypothetical protein, similar to AL109663|SC4A10.26 hypothetical protein from Streptomyces coelicolor (167 aa), FASTA scores: opt: 567, E(): 1.5e-32, (53.4% identity in 163 aa overla); shows some similarity to hypothetical protein from Methanobacterium thermoautotrophicum. Weak similarity to carbonic anhydrases e.g. U51624|MTU516242|P17582 Methanothermobacter thermautotrophicus (171 aa), FASTA score: opt: 305, E(): 1 .2e-14, (35.2% identity in 165 aa overlap). | 
| Functional category | Intermediary metabolism and respiration | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1435470 | 1435961 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1315|cana
MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESYPDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
      
    Bibliography
    No article yet recorded