Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionKey component of the proton channel; it may play a direct role in the translocation of protons (H+) across the membrane
ProductProbable ATP synthase a chain AtpB (protein 6)
CommentsRv1304, (MTCY373.24), len: 250 aa. Probable atpB, ATP synthase a chain, highly similar to ATP6_MYCLE|P45829 Mycobacterium leprae (251 aa), FASTA scores: opt: 1382, E(): 0, (84.0% identity in 250 aa overlap). Contains PS00449 ATP synthase a subunit signature. subunit: F-type ATPases have 2 components, cf(1) - the catalytic core - and cf(0) - the membrane proton channel. cf(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). cf(0) has three main subunits: A, B and C. Belongs to the ATPase a chain family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by SCOTS method, 48h and 110h after infection of cultured human primary macrophages (see Graham & Clark-Curtiss 1999). mRNA also identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002). DNA microarrays detect expression in M. tuberculosis H37Rv in vivo (in BALB/c and SCID mice) but not in vitro (in 7H9 medium) (See Talaat et al., 2004).
OperonRv1304 and Rv1305 are co-transcribed, by RT-PCR (see Roback et al., 2007). Rv1303 and Rv1304 are co-transcribed, by RT-PCR (See Sala et al., 2009).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS14602441460996+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1304|atpB
MTETILAAQIEVGEHHTATWLGMTVNTDTVLSTAIAGLIVIALAFYLRAKVTSTDVPGGVQLFFEAITIQMRNQVESAIGMRIAPFVLPLAVTIFVFILISNWLAVLPVQYTDKHGHTTELLKSAAADINYVLALALFVFVCYHTAGIWRRGIVGHPIKLLKGHVTLLAPINLVEEVAKPISLSLRLFGNIFAGGILVALIALFPPYIMWAPNAIWKAFDLFVGAIQAFIFALLTILYFSQAMELEEEHH
      
Bibliography