Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThis is one of the three chains of the nonenzymatic component (cf(0) subunit) of the ATPase complex.
ProductProbable ATP synthase C chain AtpE (lipid-binding protein) (dicyclohexylcarbodiimide-binding protein)
CommentsRv1305, (MTCY373.25), len: 81 aa. Probable atpE, ATP synthase C chain, highly similar to P45828|ATPL_MYCLE Mycobacterium leprae (92.6% identity in 81 aa overlap). Contains PS00605 ATP synthase C subunit signature. subunit: F-type ATPases have 2 components, cf(1) - the catalytic core - and cf(0) - the membrane proton channel. cf(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). cf(0) has three main subunits: A, B and C. Belongs to the ATPase C chain family.
Functional categoryIntermediary metabolism and respiration
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see citation below). DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
OperonRv1304 and Rv1305 are co-transcribed, by RT-PCR (see Roback et al., 2007).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS14610451461290+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1305|atpE
MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK