Gene Rv1325c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE-PGRS family protein PE_PGRS24 |
| Comments | Rv1325c, (MTCY130.10c), len: 603 aa. PE_PGRS24, Member of the Mycobacterium tuberculosis PE family, PGRS subfamily of ala-, gly-rich proteins (see Brennan & Delogu 2002), similar to many e.g. YQ04_MYCTU|P71933 hypothetical 63.1 kDa glycine-rich protein (778 aa), FASTA scores: E(): 0, (52.3% identity in 724 aa overlap). Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Pe/ppe |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by RT-PCR (see Banu et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1488154 | 1489965 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1325c|PE_PGRS24
MSFVIAAPETLVRAASDLANIGSTLGAANAAALGPTTELLAAGADEVSAAIASLFAAHGQAYQAVSAQMSAFHAQFVQTFTAGAGAYASAEAAAAAPLEGLLNIVNTPTQLLLGRPLIGNGANGAPGTGQAGGAGGLLYGNGGAGGSGAPGQAGGPGGAAGLFGNGGAGGAGGDGPGNGAAGGAGGAGGLLFGSGGAGGPGGVGNTGTGGLGGDGGAAGLFGAGGIGGAGGPGFNGGAGGAGGRSGLFEVLAAGGAGGTGGLSVNGGTGGTGGTGGGGGLFSNGGAGGAGGFGVSGSAGGNGGTGGDGGIFTGNGGTGGTGGTGTGNQLVGGEGGAGGAGGNAGILFGAGGIGGTGGTGLGAPDPGGTGGKGGVGGIGGAGALFGPGGAGGTGGFGASSADQMAGGIGGSGGSGGAAKLIGDGGAGGTGGDSVRGAAGSGGTGGTGGLIGDGGAGGAGGTGIEFGSVGGAGGAGGNAAGLSGAGGAGGAGGFGETAGDGGAGGNAGLLNGDGGAGGAGGLGIAGDGGNGGKGGKAGMVGNGGDGGAGGASVVANGGVGGSGGNATLIGNGGNGGNGGVGSAPGKGGAGGTAGLLGLNGSPGLS
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Banu S et al. [2002]. Are the PE-PGRS proteins of Mycobacterium tuberculosis variable surface antigens? Product Transcriptome Localization Clinical
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant