Gene Rv1332
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Involved in transcriptional mechanism. |
Product | Probable transcriptional regulatory protein |
Comments | Rv1332, (MTCY130.17), len: 218 aa. Possible regulatory protein, high similarity to ML014|U00014 M. leprae B1549_C3_236 (222 aa), FASTA scores: opt: 1158, E(): 0, (75.6% identity in 221 aa overlap). Helix turn helix motif fram aa 8-29 (+3.03 SD). |
Functional category | Regulatory proteins |
Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1500926 | 1501582 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1332|Rv1332 MPPVCGRRCSRTGEIRGYSGSIVRRWKRVETRDGPRFRSSLAPHEAALLKNLAGAMIGLLDDRDSSSPSDELEEITGIKTGHAQRPGDPTLRRLLPDFYRPDDLDDDDPTAVDGSESFNAALRSLHEPEIIDAKRVAAQQLLDTVPDNGGRLELTESDANAWIAAVNDLRLALGVMLEIGPRGPERLPGNHPLAAHFNVYQWLTVLQEYLVLVLMGSR
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant