Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved membrane protein
CommentsRv1342c, (MTCY02B10.06c), len: 120 aa. Conserved membrane protein. Highly similar to G466926|P54133 hypothetical protein B1549_F2_59 from Mycobacterium leprae (119 aa), FASTA scores, opt: 544, E(): 1.9e-29, (68.3 % identity in 120 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantDisruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS15081841508546-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv1342c|1508184-1508546|-|Rv1342c|downstream:0|upstream:0
atgaccgcacccgaaacgcccgcggcgcagcacgccgagcctgccatcgccgtcgagaggattcgcaccgctttgctcggctaccggatcatggcgtggacgacgggcctctggctcatcgcactgtgctacgagatcgtggtccgctacgtcgtcaaggttgacaatccgccgacgtggatcggtgtggtgcacggctgggtgtacttcacgtatctgcttctgacgttgaacctggcggtcaaggtccgctggccgctcggcaaaacagccggtgttctgctcgccggcacaattccgctgctcggcatcgtcgtcgagcacttccagaccaaagagatcaaggcccgcttcgggctttag
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1342c|Rv1342c
MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTWIGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL