Gene Rv1356c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv1356c, (MTCY02B10.20c), len: 263 aa. Hypothetical unknown protein. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1524029 | 1524820 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1356c|Rv1356c
VLIAGYLTDWRIMTTAQLRPIAPQKLHFSENLSVWVSDAQCRLVVSQPALDPTLWNTYLQGALRAYSKHGVECTLDLDAISDGSDTQLFFAAIDIGGDVVGGARVIGPLRSADDSHAVVEWAGNPGLSAVRKMINDRAPFGVVEVKSGWVNSDAQRSDAIAAALARALPLSMSLLGVQFVMGTAAAHALDRWRSSGGVIAARIPAAAYPDERYRTKMIWWDRRTLANHAEPKQLSRMLVESRKLLRDVEALSATTAATAGAEQ
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
