Gene Rv1366A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved protein |
| Comments | Rv1366A, len: 86 aa. Conserved protein. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in whole cell lysates but not the culture filtrate or membrane fractions of M. tuberculosis H37Rv (See de Souza et al., 2011). Identified in cell lysates and/or culture filtrates of M. tuberculosis H37Rv (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1539180 | 1539440 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1366A|Rv1366A
MRPSRQGEVGEVAGYVVEYNRRTHVRRITEFATPQEAMEHRLKLEAERTDSNIEIVALVSKSLGTLKQTHSRYFTGEELNVGNGAR
Bibliography
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
