Gene Rv1404 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Involved in transcriptional mechanism | 
| Product | Probable transcriptional regulatory protein | 
| Comments | Rv1404, (MTCY21B4.21), len: 160 aa. Probable transcriptional regulatory protein, some similarity to MARR_ECOLI|P27245 multiple antibiotic resistance protein from Escherichia coli (125 aa), FASTA scores: opt: 136, E(): 0.004, (35.1% identity in 74 aa overlap). | 
| Functional category | Regulatory proteins | 
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). | 
| Transcriptomics | mRNA identified by microarray analysis; transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). M. tuberculosis H37Rv Rv1403c-Rv1404-Rv1405c mutant grows more slowly than wild-type (See Golby et al., 2008). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1580591 | 1581073 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv1404|Rv1404
MMPTEYPATAEESVDVITDALLTASRLLVAISAHSIAQVDENITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRELLAALTKRGRDVVRQVTEHRRTEIARIVEQMAPAERHGLVRALTAFTEAGGEPDARYEIE
      
    Bibliography
    - Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Prakash P et al. [2005]. Computational prediction and experimental verification of novel IdeR binding sites in the upstream sequences of Mycobacterium tuberculosis open reading frames. Regulon
- Golby P, Nunez J, Cockle PJ, Ewer K, Logan K, Hogarth P, Vordermeier HM, Hinds J, Hewinson RG and Gordon SV [2008]. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant