Gene Rv1414
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1414, (MTCY21B4.31), len: 133 aa. Conserved hypothetical protein, similar to C-terminal part of AB010956|AB010956_1 novel metal-activated pyridoxal enzyme from Arthrobacter sp. (379 aa), FASTA scores: opt: 163, E(): 0.00063, (32.1% identity in 112 aa overlap). Rv1413 is similar to N-terminal part of same enzyme suggesting possible frameshift. Sequence has been checked and no errors found, it is identical in Mycobacterium bovis strain AF2122/97 and in Mycobacterium tuberculosis CDC1551. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1589891 | 1590292 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1414|Rv1414
VLGDAQQLELGRCAPADIALTVAATVVSRQDCRSGLRRIVLDCGSKILGSDRPAWATGFGRLIDHADARIAALSEHHATVVWPDDAPLPPVGTRLRVIPNHVCLTTNLVDDVAVVRDATLIDRWKVAARGKNH
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
