Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1414, (MTCY21B4.31), len: 133 aa. Conserved hypothetical protein, similar to C-terminal part of AB010956|AB010956_1 novel metal-activated pyridoxal enzyme from Arthrobacter sp. (379 aa), FASTA scores: opt: 163, E(): 0.00063, (32.1% identity in 112 aa overlap). Rv1413 is similar to N-terminal part of same enzyme suggesting possible frameshift. Sequence has been checked and no errors found, it is identical in Mycobacterium bovis strain AF2122/97 and in Mycobacterium tuberculosis CDC1551.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS15898911590292+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1414|Rv1414
VLGDAQQLELGRCAPADIALTVAATVVSRQDCRSGLRRIVLDCGSKILGSDRPAWATGFGRLIDHADARIAALSEHHATVVWPDDAPLPPVGTRLRVIPNHVCLTTNLVDDVAVVRDATLIDRWKVAARGKNH