Gene Rv1456c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of antibiotic across the membrane (export): unidentified antibiotic resistance by an export mechanism. Responsible for the translocation of the substrate across the membrane. |
| Product | Probable unidentified antibiotic-transport integral membrane ABC transporter |
| Comments | Rv1456c, (MTV007.03c), len: 310 aa. Possible unidentified antibiotic-transport integral membrane protein ABC transporter (see citation below), equivalent to Z99125|MLCL536.34 from Mycobacterium leprae (311 aa), FASTA scores: opt: 1607, E(): 0, (83.3% identity in 300 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1641493 | 1642425 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1456c|Rv1456c
VPYDRAVSPSLRVQRVIAAIVILTQGGIAVTGAIVRVTASGLGCPTWPQCFPGSFTPVVVAEVPRVHQAVEFGNRMVTFAVVIAAALAVLVVTRARRRTEVLAYAWLMPVSTVVQAMIGGITVRTGLLWWTVAIHLLASMTMVWLAVLLYVKIGQPDDGVVHELVVSPLRALTALSALNLAAVLVTGTLVTAAGPHAGDRSPSRTVPRLKVEITTLVHMHSSLLVAYLALLIGLGFGLLAVGATRAILVRLAVLLALVATQAAVGTTQYFTGVPAALVAIHVAGAAAVTAATAALWASMGERAQPQPLQR
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sala C et al. [2009]. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
