Gene Rv1467c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, but involvement in lipid degradation. |
| Product | Probable acyl-CoA dehydrogenase FadE15 |
| Comments | Rv1467c, (MTV007.14c), len: 609 aa. Probable fadE15, acyl-CoA dehydrogenase, highly similar to NP_302639.1|NC_002677 acyl-CoA dehydrogenase from Mycobacterium leprae (611 aa). Also highly similar to many e.g. T36481 probable acyl-CoA dehydrogenase (fragment) from Streptomyces coelicolor (491 aa) (has its N-terminus very shorter); NP_384640.1|NC_003047 putative acyl-CoA dehydrogenase protein from Sinorhizobium meliloti (598 aa); ACDS_MEGEL|Q06319 acyl-CoA dehydrogenase (short-chain specific) from Megasphaera elsdenii (383 aa), FASTA scores: E(): 2e-12, (25.4% identity in 410 aa overlap); etc. Also highly similar to fadE5|Rv0244c|MTV034.10c acyl-CoA dehydrogenase from Mycobacterium tuberculosis (611 aa); and similar to other proteins from Mycobacterium tuberculosis. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1653673 | 1655502 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1467c|fadE15
LGHYIANVRDLEFNLLEVLDIGAVLGTGRYSDLDVDTVRTILAEAARLAEGPIAESFGYADRNPPVFDPNTHSISVPDELAKTVQAIKEAGWWRLGLAEEIGGMPAPPPLAWAVNEMIYCANPSACFFNLGPVLAQSLYIEGNDEQRRWAAEGVQRGWQATMVLTEPDAGSDVGAGRTKAFEQPDGTWHIEGVKRFISGGDVGNTAENIFHLVLARPEGAGPGTKGLSLFYVPNYLFDPDTFELGARNGVYVTGLEHKMGLKSSPTCELTFGGADVPAVGYLVGGVHNGIAQMFTVIEHARMTIGVKSAGTLSTGYLNALAFAKERVQGADLTQMTDKTAPRVTIMHHPDVRRSLMTQKAYAEGLRALYLYAAAHQDDAVAQRVSGADHDMAHRVDDLLLPIVKGVGSERAYEILTESLQTLGGSGFLVDYPLEQYIRDAKIDSLYEGTTAIQALDFFFRKIVRDHGKALQFVLAQVTHTVENIDPSLKPQAELLRTALDDITAMTGALTGYLMSAAQHSSDIYKVGLGSVRYLLAVGDLLIGWRLLVLAGVAHAALADGPSQNDEAFYRGKIAVAAFFAKNMLPKLTGVRSVIENIDDDIMRVPEDAF
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
