Gene Rv1470
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol, to a disulfide, & catalyzes dithiol-disulfide exchange reactions |
| Product | Probable thioredoxin TrxA |
| Comments | Rv1470, (MTV007.17), len: 124 aa. Probable trxA, thioredoxin, similar to many e.g. P12243|THI1_SYNP7 thioredoxin 1 from Synechococcus sp. (106 aa), FASTA scores: opt: 201, E(): 9.2e-08, (35.4% identity in 99 aa overlap); etc. Highly similar to downstream ORF Rv1471|trxB1 probable thioredoxin from Mycobacterium tuberculosis (123 aa), FASTA scores: opt: 402, E(): 0, (54.4% identity in 114 aa overlap). Warning: note that Rv3914|MT4033|MTV028.05|trxC can be alternatively named trxA. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA detected by RT-PCR in M. tuberculosis H37Rv under several in vitro growth conditions (oxidative stress and control) (See Akif et al., 2008). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1658980 | 1659354 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1470|trxA
VTTRDLTAAYFQQTISANSNVLVYFWAPLCAPCDLFTPTYEASSRKHFDVVHGKVNIETEKDLASIAGVKLLPTLMAFKKGKLVFKQAGIANPAIMDNLVQQLRAYTFKSPAGEGIGPGTKTSS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Akif M et al. [2008]. Functional studies of multiple thioredoxins from Mycobacterium tuberculosis. Biochemistry Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
